HPA018207

ILDR1 antibody from Sigma-Aldrich
DFNB42, MGC50831
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018207
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018207, RRID:AB_1851742
Product name
Anti-ILDR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018207
Antibody type
Polyclonal
Antigen
Immunoglobulin-like domain-containing receptor 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEYLEKELRNLNLAQPLPPDLKGRFGHPCSMLSSL
GSEVVERRIIHLPPLIRDLSSSRRTSDSLHQQWLT
PIPSRPWDLREGRSHHHYPDFHQELQDRGPKSWAL
ERRELDPSWSGRHRSSRLNGSPIHWSDRDSLSDVP
S
Storage
-20C
Provider Type Product Number
- No reagents -