HPA018207

ILDR1 antibody from Atlas Antibodies
DFNB42, MGC50831
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018207
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018207, RRID:AB_1234572
Product name
Anti-ILDR1
Provider product page
Atlas Antibodies - HPA018207
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEYLEKELRNLNLAQPLPPDLKGRFGHPCSMLSSL
GSEVVERRIIHLPPLIRDLSSSRRTSDSLHQQWLT
PIPSRPWDLREGRSHHHYPDFHQELQDRGPKSWAL
ERRELDPSWSGRHRSSRLNGSPIHWSDRDSLSDVP
S
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -