ABIN632582

antibody from antibodies-online

Targeting: ERLEC1 C2orf30, CL25084, ERLECTIN, XTP3-B, XTP3TPB

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632582 - Provider product page
Provider: antibodies-online
Product name: anti-Endoplasmic Reticulum Lectin 1 (ERLEC1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: C2 orf30 antibody was raised using the middle region of C2 rf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

ERLEC1 protein structure - ABIN632582 shown in red.