HPA031502

ERLEC1 antibody from MilliporeSigma / Merck KGaA
C2orf30, CL25084, ERLECTIN, XTP3-B, XTP3TPB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031502
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031502, RRID:AB_10602174
Product name
Anti-C2orf30 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031502
Antibody type
Polyclonal
Antigen
endoplasmic reticulum lectin 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PYYPVGMGNGTPCSLKQNRPRSSTVMYICHPESKH
EILSVAEVTTCEYEVVILTPLLCSHPKYRFRASPV
NDIFCQSLPGS
Storage
-20C
Provider Type Product Number
- No reagents -