H00005713-B01

PSMD7 antibody from Abnova Corporation
MOV34, P40, Rpn8, S12

Antibody data

Product number
H00005713-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005713-B01, RRID:AB_1138840
Product name
PSMD7 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00005713-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PSMD7 protein.
Antigen sequence
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRV
VGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFL
DHDYLENMYGMFKKVNARERIVGWYHTGPKLHKND
IAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYIS
VEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHL
LRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRS
YLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEF
VKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKI
ANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDV
KKEEKKEKK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -