HPA017978

MFSD14B antibody from Sigma-Aldrich
FLJ14753, HIATL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017978
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017978, RRID:AB_2116836
Product name
Anti-HIATL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017978
Antibody type
Polyclonal
Antigen
Hippocampus abundant transcript-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPEYSKASGVQKHSNSSSGSLTNTPERGSDEDIEP
LLQDSSIWELSSFEEPGNQCTEL
Storage
-20C
Provider Type Product Number
- No reagents -