HPA016841

SLC25A31 antibody from Sigma-Aldrich
ANT4, DKFZP434N1235
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016841
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016841, RRID:AB_1847690
Product name
Anti-SLC25A31 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016841
Antibody type
Polyclonal
Antigen
ADP/ATP translocase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGIS
SFFRGAFSNVLRGTGGALVLVLYD
Storage
-20C
Provider Type Product Number
- No reagents -