HPA016841

SLC25A31 antibody from Atlas Antibodies
ANT4, DKFZP434N1235
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016841
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016841, RRID:AB_1847690
Product name
Anti-SLC25A31
Provider product page
Atlas Antibodies - HPA016841
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGIS
SFFRGAFSNVLRGTGGALVLVLYD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -