HPA014589

TOMM70 antibody from MilliporeSigma / Merck KGaA
KIAA0719, Tom70, TOMM70A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014589
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014589, RRID:AB_1858185
Product name
Anti-TOMM70A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014589
Antibody type
Polyclonal
Antigen
Mitochondrial precursor proteins import receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQV
EEAVADFDECIRLRPESALAQAQKCFALYRQAYTG
NNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALT
DQQQFGKADEMYDKCIDLEPDNATT
Storage
-20C
Provider Type Product Number
- No reagents -