HPA028132

MYOM3 antibody from Sigma-Aldrich
FLJ35961
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028132, RRID:AB_10599293
Product name
Anti-MYOM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028132
Antibody type
Polyclonal
Antigen
myomesin family, member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV
RDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPS
DTRGNPITAYTIERCQGESGEWI
Storage
-20C
Provider Type Product Number
- No reagents -