HPA030168

antibody from Atlas Antibodies

Targeting: KLC4 bA387M24.3, KNSL8

Antibody data

Submit

Validation data

Product number: HPA030168 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA030168, RRID:AB_10599285
Product name: Anti-KLC4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MEVTGFGVTRPGKVPQARMSGLVLGQRDEPAGHRL SQEEILGSTRLVSQGLEALRSEHQAVLQSLSQTIE CLQQGGHEEGLVHEKARQLRRSMENIELGLS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

KLC4 protein structure - HPA030168 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human duodenum and pancreas tissues using Anti-KLC4 antibody. Corresponding KLC4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, colon, kidney and testis using Anti-KLC4 antibody HPA030168 (A) shows similar protein distribution across tissues to independent antibody HPA030169 (B).
Antibody #2 product nr: HPA030169
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland using Anti-KLC4 antibody HPA030168.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-KLC4 antibody HPA030168.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-KLC4 antibody HPA030168.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-KLC4 antibody HPA030168.
Sample type: HUMAN