H00089953-B01

KLC4 antibody from Abnova Corporation
bA387M24.3, KNSL8

Antibody data

Product number
H00089953-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00089953-B01, RRID:AB_1138521
Product name
KLC4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00089953-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KLC4 protein.
Antigen sequence
MSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLEA
LRSEHQAVLQSLSQTIECLQQGGHEEGLVHEKARQ
LRRSMENIELGLSEAQVMLALASHLSTVESEKQKL
RAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQL
EEEKKHLEFLGQLRQYDEDGHTSEEKEGDATKDSL
DDLFPNEEEEDPSNGLSRGQGATAAQQGGYEIPAR
LRTLHNLVIQYAAQGRYEVAVPLCKQALEDLERTS
GRGHPDVATMLNILALVYRDQNKYKEAAHLLNDAL
SIRESTLGPDHPAVAATLNNLAVLYGKRGKYKEAE
PLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQ
GKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNL
ASCYLKQGKYAEAETLYKEILTRAHVQEFGSVDDD
HKPIWMHAEEREEMSKSRHHEGGTPYAEYGGWYKA
CKVSSPTVNTTLRNLGALYRRQGKLEAAETLEECA
LRSRRQGTDPISQTKVAELLGESDGRRTSQEGPGD
SVKFEGGEDASVAVEWSGDGSGTLQRSGSLGKIRD
VLRRSSELLVRKLQGTEPRPSSSNMKRAASLNYLN
QPSAAPLQVSRGLSASTMDLSSSS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -