HPA014591

PIP4P2 antibody from MilliporeSigma / Merck KGaA
DKFZp762O076, TMEM55A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014591
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014591, RRID:AB_1858124
Product name
Anti-TMEM55A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014591
Antibody type
Polyclonal
Antigen
Transmembrane protein 55A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLIS
EEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFN
TLAKCPHCKKISSVGSA
Storage
-20C
Provider Type Product Number
- No reagents -