HPA014591

TMEM55A antibody from Sigma-Aldrich
DKFZp762O076
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014591
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014591, RRID:AB_1858124
Product name
Anti-TMEM55A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014591
Antibody type
Polyclonal
Antigen
Transmembrane protein 55A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLIS
EEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFN
TLAKCPHCKKISSVGSA
Storage
-20C
Provider Type Product Number
- No reagents -