Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405006 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Homeobox B2 (HOXB2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HOXB2 antibody: synthetic peptide directed towards the N terminal of human HOXB2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAK
KPSQS ATSPSPAASA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references HOXB2 as a novel prognostic indicator for stage I lung adenocarcinomas.
Inamura K, Togashi Y, Okui M, Ninomiya H, Hiramatsu M, Satoh Y, Okumura S, Nakagawa K, Shimoji T, Noda T, Ishikawa Y
Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer 2007 Sep;2(9):802-7
Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer 2007 Sep;2(9):802-7
No comments: Submit comment
No validations: Submit validation data