Antibody data

Product number
ABIN405006
Provider
antibodies-online
Product name
anti-Homeobox B2 (HOXB2) (N-Term) antibody
Provider product page
antibodies-online - ABIN405006
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXB2 antibody: synthetic peptide directed towards the N terminal of human HOXB2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAK
KPSQS ATSPSPAASA
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -