Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1544357 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon-Induced Protein with Tetratricopeptide Repeats 1 (IFIT1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for Anti-IFIT1 antibody is: synthetic peptide directed towards the C-terminal region of Human IFIT1
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
ALELLKKALQETPTSVLLHHQIGLCYKAQMIQIKE
ATKGQ PRGQNREKLD- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-IFIT1 AntibodyTitration: 1.0 μg/mL Positive Control: Fetal Stomach
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-IFIT1 Antibody Positive Control: Lane1:341 μg human Huh7, Lane2: 041 μg human Huh7+IFNB stimulated Primary Antibody Dilution: 1:0000Secondary Antibody: Anti-rabbit-HRP Secondry Antibody Dilution: 1:0000Submitted by: Takeshi Saito, USC Keck School of Medicine