HPA014670

ZDHHC5 antibody from Sigma-Aldrich
KIAA1748, ZNF375
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014670
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014670, RRID:AB_2257442
Product name
Anti-ZDHHC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014670
Antibody type
Polyclonal
Antigen
Palmitoyltransferase ZDHHC5, probable recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHR
EPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGRE
EEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLG
KTPLGRPAVPRFGKPDGLRGRGVGSPE
Storage
-20C
Provider Type Product Number
- No reagents -