Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014670 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA014670, RRID:AB_2257442
- Product name
- Anti-ZDHHC5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHR
EPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGRE
EEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLG
KTPLGRPAVPRFGKPDGLRGRGVGSPE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Activity-regulated trafficking of the palmitoyl-acyl transferase DHHC5.
Palmitoylation of δ-catenin by DHHC5 mediates activity-induced synapse plasticity
DHHC5 protein palmitoylates flotillin-2 and is rapidly degraded on induction of neuronal differentiation in cultured cells.
DHHC5 interacts with PDZ domain 3 of post-synaptic density-95 (PSD-95) protein and plays a role in learning and memory.
Brigidi GS, Santyr B, Shimell J, Jovellar B, Bamji SX
Nature communications 2015 Sep 3;6:8200
Nature communications 2015 Sep 3;6:8200
Palmitoylation of δ-catenin by DHHC5 mediates activity-induced synapse plasticity
Brigidi G, Sun Y, Beccano-Kelly D, Pitman K, Mobasser M, Borgland S, Milnerwood A, Bamji S
Nature Neuroscience 2014 February;17(4):522-532
Nature Neuroscience 2014 February;17(4):522-532
DHHC5 protein palmitoylates flotillin-2 and is rapidly degraded on induction of neuronal differentiation in cultured cells.
Li Y, Martin BR, Cravatt BF, Hofmann SL
The Journal of biological chemistry 2012 Jan 2;287(1):523-530
The Journal of biological chemistry 2012 Jan 2;287(1):523-530
DHHC5 interacts with PDZ domain 3 of post-synaptic density-95 (PSD-95) protein and plays a role in learning and memory.
Li Y, Hu J, Höfer K, Wong AM, Cooper JD, Birnbaum SG, Hammer RE, Hofmann SL
The Journal of biological chemistry 2010 Apr 23;285(17):13022-31
The Journal of biological chemistry 2010 Apr 23;285(17):13022-31
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cell junctions.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gallbladder shows membranous positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human esophagus shows membranous positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine shows membranous positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows membranous positivity in exocrine glandular cells.
- Sample type
- HUMAN