Antibody data

Product number
H00092399-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00092399-M11, RRID:AB_1237791
Product name
MRRF monoclonal antibody (M11), clone 3E3
Provider product page
Abnova Corporation - H00092399-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MRRF.
Antigen sequence
MALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVH
ERQHGHRQYMAYSAVPVRHFATKKAKAKGKGQSQT
RVNINAALVEDIINLEEVNEEMKSVIEALKDNFNK
TLNIRTSPGSLDKIAVVTADGKLALNQISQISMKS
PQLILVNMASFPECTAAAIKAIRESGMNLNPEVEG
TLIRVPIPQVTREHREMLVKLAKQNTNKAKDSLRK
VRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDT
VAELDRHLAVKTKELLG
Isotype
IgG
Antibody clone number
3E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -