HPA015988

C1orf27 antibody from Atlas Antibodies
FLJ20505, odr-4, TTG1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015988
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015988, RRID:AB_1233611
Product name
Anti-C1orf27
Provider product page
Atlas Antibodies - HPA015988
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDH
FMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASL
DNTDDEQPKQPIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -