HPA015988

ODR4 antibody from Atlas Antibodies
C1orf27, FLJ20505, odr-4, TTG1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015988
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015988, RRID:AB_1845644
Product name
Anti-C1orf27
Provider product page
Atlas Antibodies - HPA015988
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDH
FMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASL
DNTDDEQPKQPIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -