HPA016702

KCNJ15 antibody from Sigma-Aldrich
IRKK, Kir1.3, Kir4.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016702
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016702, RRID:AB_1855560
Product name
Anti-KCNJ15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016702
Antibody type
Polyclonal
Antigen
ATP-sensitive inward rectifier potassium channel 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVA
DFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTL
Storage
-20C
Provider Type Product Number
- No reagents -