HPA016702

KCNJ15 antibody from Atlas Antibodies
IRKK, Kir1.3, Kir4.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016702
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016702, RRID:AB_1855560
Product name
Anti-KCNJ15
Provider product page
Atlas Antibodies - HPA016702
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVA
DFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -