HPA027470

ZNRF1 antibody from Sigma-Aldrich
DKFZp434E229, FLJ14846, nin283
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027470
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027470, RRID:AB_10603108
Product name
Anti-ZNRF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027470
Antibody type
Polyclonal
Antigen
zinc and ring finger 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLAD
ALPLPIAPRWFSSHSGFKCPICSKSVASDEMEMHF
I
Storage
-20C
Provider Type Product Number
- No reagents -