Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031395 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031395, RRID:AB_10601584
- Product name
- Anti-KPNA7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LLQHNKPSIQKEAAWALSNVAAGPCHHIQQLLAYD
VLPPLVALLKNGEFKVQKEAVWMVANFATGATMDQ
LIQLVHSGVLEPLVNLLTAPDVK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Karyopherin α deficiency contributes to human preimplantation embryo arrest
An epilepsy-associated mutation in the nuclear import receptor KPNA7 reduces nuclear localization signal binding
Wang W, Miyamoto Y, Chen B, Shi J, Diao F, Zheng W, Li Q, Yu L, Li L, Xu Y, Wu L, Mao X, Fu J, Li B, Yan Z, Shi R, Xue X, Mu J, Zhang Z, Wu T, Zhao L, Wang W, Zhou Z, Dong J, Li Q, Jin L, He L, Sun X, Lin G, Kuang Y, Wang L, Sang Q
Journal of Clinical Investigation 2023;133(2)
Journal of Clinical Investigation 2023;133(2)
An epilepsy-associated mutation in the nuclear import receptor KPNA7 reduces nuclear localization signal binding
Oostdyk L, Wang Z, Zang C, Li H, McConnell M, Paschal B
Scientific Reports 2020;10(1)
Scientific Reports 2020;10(1)
No comments: Submit comment
No validations: Submit validation data