H00003218-M01A

HOXB8 antibody from Abnova Corporation
HOX2, HOX2D
No application information provided.

Antibody data

Product number
H00003218-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003218-M01A, RRID:AB_1237735
Product name
HOXB8 monoclonal antibody (M01A), clone 4F8
Provider product page
Abnova Corporation - H00003218-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HOXB8.
Antigen sequence
GESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQH
PSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNF
YGYDPLQRQSLFGAQDPDLVQYADCKLAA
Isotype
IgG
Antibody clone number
4F8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -