HPA015280

CACFD1 antibody from Sigma-Aldrich
C9orf7, D9S2135, flower
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015280
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015280, RRID:AB_1845833
Product name
Anti-C9orf7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015280
Antibody type
Polyclonal
Antigen
Transmembrane protein C9orf7
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQA
DEEKLAETLE
Storage
-20C
Provider Type Product Number
- No reagents -