SAB2100429

CHST6 antibody from MilliporeSigma / Merck KGaA
MCDC1
No application information provided.

Antibody data

Product number
SAB2100429
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-CHST6 (ab2) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100429
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_067628.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YAFTGLSLTPQLEAWIHNITHGSGPGARREAFKTS
SRNALNVSQAWRHAL
Storage
-20C