H00023563-M05

CHST5 antibody from Abnova Corporation
FLJ22167, I-GLCNAC-6-ST

Antibody data

Product number
H00023563-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023563-M05, RRID:AB_1573982
Product name
CHST5 monoclonal antibody (M05), clone 2E6
Provider product page
Abnova Corporation - H00023563-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CHST5.
Antigen sequence
GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKIL
RVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPR
GPDHFSWASPD
Isotype
IgG
Antibody clone number
2E6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -