Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023563-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023563-M05, RRID:AB_1573982
- Product name
- CHST5 monoclonal antibody (M05), clone 2E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CHST5.
- Antigen sequence
GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKIL
RVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPR
GPDHFSWASPD- Isotype
- IgG
- Antibody clone number
- 2E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Galacto-oligosaccharides may directly enhance intestinal barrier function through the modulation of goblet cells.
Bhatia S, Prabhu PN, Benefiel AC, Miller MJ, Chow J, Davis SR, Gaskins HR
Molecular nutrition & food research 2015 Mar;59(3):566-73
Molecular nutrition & food research 2015 Mar;59(3):566-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CHST5 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol