HPA017770

LY6K antibody from Sigma-Aldrich
CT97, FLJ35226, HSJ001348
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017770
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017770, RRID:AB_1853414
Product name
Anti-LY6K antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017770
Antibody type
Polyclonal
Antigen
Lymphocyte antigen 6K Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCV
IAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFL
LEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG
Storage
-20C
Provider Type Product Number
- No reagents -