Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006233-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006233-M01, RRID:AB_437057
- Product name
- RPS27A monoclonal antibody (M01), clone 3E2-E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant RPS27A.
- Antigen sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
LRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKY
YKVDENGKISRLRRECPSDECGAGVFMASHFDRHY
CGKCCLTYCFNKPEDK- Isotype
- IgG
- Antibody clone number
- 3E2-E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Altered dynamics of ubiquitin hybrid proteins during tumor cell apoptosis.
The HBx protein of hepatitis B virus regulates the expression, intracellular distribution and functions of ribosomal protein S27a.
Chemoprevention with aqueous extract of Butea monosperma flowers results in normalization of nuclear morphometry and inhibition of a proliferation marker in liver tumors.
Han XJ, Lee MJ, Yu GR, Lee ZW, Bae JY, Bae YC, Kang SH, Kim DG
Cell death & disease 2012 Jan 19;3:e255
Cell death & disease 2012 Jan 19;3:e255
The HBx protein of hepatitis B virus regulates the expression, intracellular distribution and functions of ribosomal protein S27a.
Fatima G, Mathan G, Kumar V
The Journal of general virology 2012 Apr;93(Pt 4):706-15
The Journal of general virology 2012 Apr;93(Pt 4):706-15
Chemoprevention with aqueous extract of Butea monosperma flowers results in normalization of nuclear morphometry and inhibition of a proliferation marker in liver tumors.
Mathan G, Fatima G, Saxena AK, Chandan BK, Jaggi BS, Gupta BD, Qazi GN, Balasundaram C, Anand Rajan KD, Kumar VL, Kumar V
Phytotherapy research : PTR 2011 Mar;25(3):324-8
Phytotherapy research : PTR 2011 Mar;25(3):324-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RPS27A monoclonal antibody (M01), clone 3E2-E6 Western Blot analysis of RPS27A expression in HL-60 ( Cat # L014V1 ).