Antibody data

Product number
H00006233-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006233-M02, RRID:AB_1204929
Product name
RPS27A monoclonal antibody (M02), clone 2G10
Provider product page
Abnova Corporation - H00006233-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RPS27A.
Antigen sequence
SDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKN
KHKRKKVKLAVLKYYKVDENGKISRLRRECPSDEC
GAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Isotype
IgG
Antibody clone number
2G10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -