HPA014476

TMEM143 antibody from Sigma-Aldrich
FLJ10922
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014476
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014476, RRID:AB_1858092
Product name
Anti-TMEM143 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014476
Antibody type
Polyclonal
Antigen
Transmembrane protein 143 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MWNPREPRDWAQQYRERFIPFSKEQLLRLLIQEFH
SSPAEKAALEAFSAHVDFCTLFHYHQILARLQALY
DPINPDRETLDQPSLTDPQRLSNEQEVLRALEPLL
AQANFSPLSEDTLAYALVVHHPQDEVQVTVNLDQY
V
Storage
-20C
Provider Type Product Number
- No reagents -