HPA014476

TMEM143 antibody from Atlas Antibodies
FLJ10922
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014476
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014476, RRID:AB_1235941
Product name
Anti-TMEM143
Provider product page
Atlas Antibodies - HPA014476
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MWNPREPRDWAQQYRERFIPFSKEQLLRLLIQEFH
SSPAEKAALEAFSAHVDFCTLFHYHQILARLQALY
DPINPDRETLDQPSLTDPQRLSNEQEVLRALEPLL
AQANFSPLSEDTLAYALVVHHPQDEVQVTVNLDQY
V
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -