ABIN1109459

SNF8 antibody from antibodies-online
Dot3, EAP30, VPS22

Antibody data

Product number
ABIN1109459
Provider
antibodies-online
Product name
anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody
Provider product page
antibodies-online - ABIN1109459
Antibody type
Polyclonal
Antigen
The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30
Description
Purified on peptide immunoaffinity column
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQ
MSKQLDMFKTNLEEF
Epitope
N-Term
Vial size
50 μg
Storage
Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.