HPA014601

TMCO4 antibody from Sigma-Aldrich
DKFZp686C23231
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014601
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014601, RRID:AB_2204302
Product name
Anti-TMCO4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014601
Antibody type
Polyclonal
Antigen
Transmembrane and coiled-coil domain-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKD
PILKDDPTVITQDLLSFSLKDGHYDARARVLVCHM
TSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEA
SRKKKE
Storage
-20C
Provider Type Product Number
- No reagents -