Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182826 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ribosomal Protein S16 (RPS16) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RPS16 antibody: synthetic peptide directed towards the N terminal of human RPS16
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGR
PLEMI EPRTLQYKLL- Vial size
- 0.1 mg
Submitted references Identification and expression of an autosomal paralogue of ribosomal protein S4, X-linked, in mice: potential involvement of testis-specific ribosomal proteins in translation and spermatogenesis.
Expression analysis of MIF4GD in the rat testis.
The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
Sugihara Y, Sadohara E, Yonezawa K, Kugo M, Oshima K, Matsuda T, Nadano D
Gene 2013 May 25;521(1):91-9
Gene 2013 May 25;521(1):91-9
Expression analysis of MIF4GD in the rat testis.
Okada K, Kimura M, Moriyama Y, Nakai M, Kikuchi K, Kaneko H, Kunieda T, Baba T, Noguchi J
The Journal of reproduction and development 2011 Apr;57(2):256-61
The Journal of reproduction and development 2011 Apr;57(2):256-61
The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
Yoshihama M, Uechi T, Asakawa S, Kawasaki K, Kato S, Higa S, Maeda N, Minoshima S, Tanaka T, Shimizu N, Kenmochi N
Genome research 2002 Mar;12(3):379-90
Genome research 2002 Mar;12(3):379-90
No comments: Submit comment
No validations: Submit validation data