Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057804-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057804-M01A, RRID:AB_733240
- Product name
- POLD4 monoclonal antibody (M01A), clone 2B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant POLD4.
- Antigen sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL- Isotype
- IgG
- Antibody clone number
- 2B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Replication stress activates DNA repair synthesis in mitosis.
Regulation of DNA polymerase POLD4 influences genomic instability in lung cancer.
Roles of POLD4, smallest subunit of DNA polymerase delta, in nuclear structures and genomic stability of human cells.
A novel DNA damage response: rapid degradation of the p12 subunit of dna polymerase delta.
Minocherhomji S, Ying S, Bjerregaard VA, Bursomanno S, Aleliunaite A, Wu W, Mankouri HW, Shen H, Liu Y, Hickson ID
Nature 2015 Dec 10;528(7581):286-90
Nature 2015 Dec 10;528(7581):286-90
Regulation of DNA polymerase POLD4 influences genomic instability in lung cancer.
Huang QM, Tomida S, Masuda Y, Arima C, Cao K, Kasahara TA, Osada H, Yatabe Y, Akashi T, Kamiya K, Takahashi T, Suzuki M
Cancer research 2010 Nov 1;70(21):8407-16
Cancer research 2010 Nov 1;70(21):8407-16
Roles of POLD4, smallest subunit of DNA polymerase delta, in nuclear structures and genomic stability of human cells.
Huang QM, Akashi T, Masuda Y, Kamiya K, Takahashi T, Suzuki M
Biochemical and biophysical research communications 2010 Jan 1;391(1):542-6
Biochemical and biophysical research communications 2010 Jan 1;391(1):542-6
A novel DNA damage response: rapid degradation of the p12 subunit of dna polymerase delta.
Zhang S, Zhou Y, Trusa S, Meng X, Lee EY, Lee MY
The Journal of biological chemistry 2007 May 25;282(21):15330-40
The Journal of biological chemistry 2007 May 25;282(21):15330-40
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged POLD4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol