HPA016633

LINGO2 antibody from Sigma-Aldrich
LERN3, LRRN6C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016633
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016633, RRID:AB_1853362
Product name
Anti-LINGO2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016633
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIAS
NAAGNDTFTASLTVKGFASDRFLYANRTPMY
Storage
-20C
Provider Type Product Number
- No reagents -