HPA029675

DNPH1 antibody from MilliporeSigma / Merck KGaA
C6orf108, dJ330M21.3, rcl
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029675
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029675, RRID:AB_10599998
Product name
Anti-C6orf108 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029675
Antibody type
Polyclonal
Antigen
Deoxyribonucleoside 5'-monophosphate N-glycosidase (EC 3.2.2.-)(c-Myc-responsive protein Rcl) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAM
IRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQ
Storage
-20C
Provider Type Product Number
- No reagents -