Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406515 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Guanine Nucleotide Binding Protein (G Protein), gamma Transducing Activity Polypeptide 2 (GNGT2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GNGT2 antibody: synthetic peptide directed towards the middle region of human GNGT2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIP
EDKNP FKEKGGCLIS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The molecular basis for T-type Ca2+ channel inhibition by G protein beta2gamma2 subunits.
DePuy SD, Yao J, Hu C, McIntire W, Bidaud I, Lory P, Rastinejad F, Gonzalez C, Garrison JC, Barrett PQ
Proceedings of the National Academy of Sciences of the United States of America 2006 Sep 26;103(39):14590-5
Proceedings of the National Academy of Sciences of the United States of America 2006 Sep 26;103(39):14590-5
No comments: Submit comment
No validations: Submit validation data