Antibody data

Product number
ABIN785687
Provider
antibodies-online
Product name
anti-IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2) (N-Term) antibody
Provider product page
antibodies-online - ABIN785687
Antibody type
Polyclonal
Antigen
The immunogen for anti-IMPDH2 antibody: synthetic peptide directed towards the N terminal of human IMPDH2
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDF
LILPG YIDFTADQVD
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -