Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00162466-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00162466-M04, RRID:AB_530174
- Product name
- PHOSPHO1 monoclonal antibody (M04), clone 4B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PHOSPHO1.
- Antigen sequence
CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVG
DGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQK
AEPSSFRASVVPWETAADVRLHLQQVLKS- Isotype
- IgG
- Antibody clone number
- 4B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Phosphatidylethanolamine biomimetic coating increases mesenchymal stem cell osteoblastogenesis.
Luthringer BJ, Katha UM, Willumeit R
Journal of materials science. Materials in medicine 2014 Nov;25(11):2561-71
Journal of materials science. Materials in medicine 2014 Nov;25(11):2561-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PHOSPHO1 monoclonal antibody (M04), clone 4B2 Western Blot analysis of PHOSPHO1 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PHOSPHO1 monoclonal antibody (M04), clone 4B2. Western Blot analysis of PHOSPHO1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PHOSPHO1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol