HPA023211

GRPEL2 antibody from Atlas Antibodies
DKFZp451C205, FLJ23713, Mt-GrpE#2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023211
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023211, RRID:AB_1850360
Product name
Anti-GRPEL2
Provider product page
Atlas Antibodies - HPA023211
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQ
RTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKE
VQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQ
SFCKDLVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -