HPA018173

GRPEL2 antibody from Sigma-Aldrich
DKFZp451C205, FLJ23713, Mt-GrpE#2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018173
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018173, RRID:AB_1850358
Product name
Anti-GRPEL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018173
Antibody type
Polyclonal
Antigen
GrpE protein homolog 2, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKL
TPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQD
GYKLHGRTIRLARVEVAVES
Storage
-20C
Provider Type Product Number
- No reagents -