HPA018173

GRPEL2 antibody from Atlas Antibodies
DKFZp451C205, FLJ23713, Mt-GrpE#2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018173
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018173, RRID:AB_1850358
Product name
Anti-GRPEL2
Provider product page
Atlas Antibodies - HPA018173
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKL
TPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQD
GYKLHGRTIRLARVEVAVES
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -