HPA029500

ZNF789 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029500
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029500, RRID:AB_10603009
Product name
Anti-ZNF789 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029500
Antibody type
Polyclonal
Antigen
zinc finger protein 789 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CRLTFPTSGDEYSRGFLQNLNLIQDQNAQTRWKQG
RYDEDGKPFNQRSLLLGHERILTRAKSYECSECGK
VIRRKAWFDQHQRIHF
Storage
-20C
Provider Type Product Number
- No reagents -