Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183158 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRIK2 antibody: synthetic peptide directed towards the N terminal of human GRIK2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIK
APSRY NLRLKIRQLP- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Maternal transmission disequilibrium of the glutamate receptor GRIK2 in schizophrenia.
Bah J, Quach H, Ebstein RP, Segman RH, Melke J, Jamain S, Rietschel M, Modai I, Kanas K, Karni O, Lerer B, Gourion D, Krebs MO, Etain B, Schürhoff F, Szöke A, Leboyer M, Bourgeron T
Neuroreport 2004 Aug 26;15(12):1987-91
Neuroreport 2004 Aug 26;15(12):1987-91
No comments: Submit comment
No validations: Submit validation data