Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183159 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRIK2 antibody: synthetic peptide directed towards the C terminal of human GRIK2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVE
DGATM TFFKKSKIST- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Maternal transmission disequilibrium of the glutamate receptor GRIK2 in schizophrenia.
Bah J, Quach H, Ebstein RP, Segman RH, Melke J, Jamain S, Rietschel M, Modai I, Kanas K, Karni O, Lerer B, Gourion D, Krebs MO, Etain B, Schürhoff F, Szöke A, Leboyer M, Bourgeron T
Neuroreport 2004 Aug 26;15(12):1987-91
Neuroreport 2004 Aug 26;15(12):1987-91
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting