HPA014623

GRIK2 antibody from Sigma-Aldrich
GluK2, GLUR6, MRT6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014623
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014623, RRID:AB_1850305
Product name
Anti-GRIK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014623
Antibody type
Polyclonal
Antigen
Glutamate receptor, ionotropic kainate 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPAS
GLNMTESQKGKPANITDSLSNRSLIVTTILEEPYV
LFKKSDKPLYGNDRFEGYCIDLL
Storage
-20C
Provider Type Product Number
- No reagents -